U heeft gezocht op: Columbia Biosciences


218  results were found

SearchResultCount:"218"

Sort Results

List view Easy View (new)

Rate These Search Results

Catalogus nummer: (COBSD3-110-M)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgM Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSAP-1834)
Leverancier: Columbia Biosciences
Omschrijving: Anti-V5 Tag Rabbit Polyclonal Antibody (AP (Alkaline Phosphatase))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD3-112-FABFC)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD3-1866-50)
Leverancier: Columbia Biosciences
Omschrijving: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG Goat Polyclonal Antibody (RPE (R-Phycoerythrin))

Catalogus nummer: (COBSD8-1832)
Leverancier: Columbia Biosciences
Omschrijving: Anti-T7 Tag Rabbit Polyclonal Antibody (DyLight® 488)
UOM: 1 * 1 EA


Catalogus nummer: (COBSAP-1718)
Leverancier: Columbia Biosciences
Omschrijving: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (AP (Alkaline Phosphatase)) [clone: M2]
UOM: 1 * 1 EA


Catalogus nummer: (COBSD3-112-3)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG3 Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD3-112-FAB)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD3-113-FAB)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG Goat Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD5-1832)
Leverancier: Columbia Biosciences
Omschrijving: Anti-T7 Tag Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 1 EA


Catalogus nummer: (COBSD11-1310)
Leverancier: Columbia Biosciences
Omschrijving: Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (Peridinin Chlorophyll)
UOM: 1 * 1 EA


Catalogus nummer: (COBSD7-1310)
Leverancier: Columbia Biosciences
Omschrijving: Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (SureLight® P3)
UOM: 1 * 1 EA


Catalogus nummer: (COBSD7-114)
Leverancier: Columbia Biosciences
Omschrijving: Anti-IgG Goat Polyclonal Antibody (SureLight® P3)
UOM: 1 * 1 mg


Catalogus nummer: (COBSD11-1711)
Leverancier: Columbia Biosciences
Omschrijving: Anti-6X His tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: AD1.1.10]
UOM: 1 * 1 EA


Catalogus nummer: (COBSD5-1863-50)
Leverancier: Columbia Biosciences
Omschrijving: Anti-EP2 receptor Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 1 EA


Bel voor prijs
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
Dit artikel is geblokkeerd voor uw organisatie. Neem contact op met uw inkoopafdeling voor meer informatie
Het orginele artikel is niet langer beschikbaar. Het alternatief dat wordt getoond is beschikbaar
Product(en) gemarkeerd met dit symbool worden niet meer verkocht cq verkocht tot het einde van de voorraad. Alternatieven zijn mogelijk beschikbaar door te zoeken met het VWR-catalogusnummer dat hierboven wordt vermeld. Voor meer informatie kunt u contact opnemen met customer service: 020-4808410.
65 - 80 of 218
no targeter for Bottom